> For the complete documentation index, see [llms.txt](https://docs.rplpeptides.com/llms.txt). Markdown versions of documentation pages are available by appending `.md` to page URLs; this page is available as [Markdown](https://docs.rplpeptides.com/docs/tesamorelin/01-product-overview/tesamorelin-product-overview.md). # tesamorelin-product-overview ### Chapter 1: Product Overview ### 1.1 Product Identity | Field | Value | | --------------------- | ------------------------------------------------------------------------ | | **Product Name** | Tesamorelin | | **CAS Number** | 218949-42-4 | | **Common Synonyms** | TH9507; Growth Hormone Releasing Factor (1-44) analog; GRF (1-44) analog | | **Product Type** | Synthetic peptide; GHRH analog | | **Amino Acid Length** | 44 amino acids | | **Molecular Formula** | C₂₂₁H₃₆₆N₇₂O₆₇S | | **Molecular Weight** | 5,135.90 Da | | **Purity (Standard)** | ≥98% (by HPLC) | | **Appearance** | White to off-white lyophilized powder | | **Packaging Options** | 2 mg, 5 mg, 10 mg per vial; 10 vials per box | ### 1.2 Structural Description Tesamorelin is a synthetic 44-amino-acid analog of endogenous human growth hormone-releasing hormone (GHRH). It corresponds to the full-length human GHRH(1-44)-NH₂ sequence with a key structural modification: the N-terminal tyrosine residue is modified with a *trans*-3-hexenoyl group. This N-terminal acylation confers resistance to enzymatic degradation by dipeptidyl peptidase-4 (DPP-4), significantly extending the peptide's in vivo half-life compared to native GHRH. The C-terminus is amidated (-NH₂), consistent with the native hormone, which supports receptor binding affinity and biological activity. **Primary sequence (44 residues):**\ *trans*-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ **Single-letter code:** YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂ (with N-terminal hexenoyl modification on Tyr¹) ### 1.3 Mechanism of Action Tesamorelin acts as a selective agonist of the growth hormone-releasing hormone (GHRH) receptor (GHRHR) on pituitary somatotroph cells. Upon receptor binding, it stimulates the synthesis and pulsatile secretion of endogenous growth hormone (GH), which in turn stimulates hepatic production of insulin-like growth factor 1 (IGF-1). This GH/IGF-1 axis activation reproduces the physiological effects of endogenous GHRH. Unlike recombinant human GH (rhGH) replacement therapy, Tesamorelin preserves the endogenous feedback regulation of the GH axis, including the negative feedback modulation by IGF-1 and somatostatin. ### 1.4 Key Features * **Full-length GHRH analog**: Retains the complete 44-amino-acid sequence of native human GHRH * **DPP-4 resistant**: N-terminal *trans*-3-hexenoyl modification confers protection against rapid enzymatic degradation * **Enhanced stability**: Improved pharmacokinetic profile compared to unmodified GHRH(1-44) * **Preserved bioactivity**: Maintains full GHRH receptor binding and signaling properties * **High purity**: ≥98% by HPLC with comprehensive analytical characterization ### 1.5 Intended Research Use Tesamorelin is intended for laboratory research purposes only. It is not for human or veterinary therapeutic use. Common research applications include: * Endocrine and neuroendocrine research * GH/IGF-1 axis signaling studies * Metabolic research including lipodystrophy models * Pituitary function and somatotroph cell biology * Aging and sarcopenia research * Preclinical pharmacokinetic and pharmacodynamic studies * DPP-4 resistance and peptide stability studies ### 1.6 Regulatory Classification Tesamorelin is classified as a laboratory research chemical/reagent. It is not an FDA-approved pharmaceutical product when sold as a research chemical. In clinical contexts, Tesamorelin (Egrifta™) has been approved by the FDA for the treatment of HIV-associated lipodystrophy. *** *© 2026 Qingdao RPL Biotechnology Co., Ltd. All rights reserved.* *Document ID: RPL-TM-TES-001 | Version 1.0 | July 2026* *For laboratory research use only. Not for human or veterinary use.* *Address: Qingdao, China | Web: * *** --- # Agent Instructions This documentation is published with GitBook. GitBook is the documentation platform designed so that both humans and AI agents can read, navigate, and reason over technical content effectively. Learn more at gitbook.com. ## Querying This Documentation If you need additional information that is not directly available in this page, you can query the documentation dynamically by asking a question. Perform an HTTP GET request on the current page URL with the `ask` query parameter, and the optional `goal` query parameter: ``` GET https://docs.rplpeptides.com/docs/tesamorelin/01-product-overview/tesamorelin-product-overview.md?ask=&goal= ``` `ask` is the immediate question: it should be specific, self-contained, and written in natural language. `goal` is optional and describes the broader end goal you are ultimately trying to accomplish on behalf of the user. GitBook uses it to tailor the answer towards what is most useful for that goal. The response will contain a direct answer to the question and relevant excerpts and sources from the documentation. Use this mechanism when the answer is not explicitly present in the current page, you need clarification or additional context, or you want to retrieve related documentation sections.